Reverse-phase HPLC comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-02-05. Where a claim depends on a specific study, the study is described rather than over-claimed.
Clinical development of this compound followed earlier short-acting GLP-1 analogues that required frequent injection. Once-weekly subcutaneous formulations entered use after 2017, and an oral formulation using a permeation enhancer later became available. The oral version pairs the peptide with sodium N-(8-[2-hydroxybenzoyl] amino) caprylate, a carrier that improves uptake across the gastric epithelium. Interest has expanded from glycaemic control into weight management and metabolic liver disease. Regulatory status and approved indications differ between countries, and the product remains subject to ongoing safety monitoring.
Semaglutide is a synthetic peptide that acts as an agonist at the glucagon-like peptide-1 receptor. It is a structural analogue of human GLP-1(7-37), modified to resist enzymatic degradation by dipeptidyl peptidase-4. The peptide backbone contains alpha-aminoisobutyric acid at position 8, a substitution that stabilises the helix and slows cleavage. A fatty diacid side chain attached through a linker at lysine 34 promotes binding to serum albumin, which extends the circulating half-life. These two modifications together allow less frequent administration than native GLP-1 requires.
Activation of the GLP-1 receptor couples to Gs signalling and raises intracellular cyclic AMP in pancreatic beta cells. The resulting insulin release depends on prevailing glucose concentrations, so the effect is greater when glucose is elevated. Receptor engagement also suppresses glucagon secretion and slows gastric emptying, which flattens post-meal glucose excursions. In the central nervous system, signalling in hypothalamic and brainstem regions is associated with reduced appetite and lower energy intake. Studies continue to examine effects on cardiac, renal and hepatic endpoints; whether those benefits are independent of weight change remains an open question.
Two principal therapeutic variants exist under separate regulatory filings, one indicated for glycemic control in type 2 diabetes and one for chronic weight management. Both use the same active molecule; differences lie in formulation strength, titration schedule, and labeling. Regulatory agencies in the United States and European Union approved injectable forms in 2017 and 2018 respectively. An oral tablet formulation received approval later, using a carrier molecule to enhance absorption across the gastric epithelium. Labeling differs by jurisdiction and by indication.
The distinction between established facts and open questions matters here. That the peptide binds the GLP-1 receptor and stimulates insulin release in a glucose-dependent manner is well documented. How individual variability in receptor density, gastric emptying rate, and gut microbiome composition shapes response remains an active research area. Long-term outcomes beyond five years of continuous use are not yet fully characterized in published trials, and several extension studies are ongoing.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C187H291N45O59 | Parent peptide; salt forms also reported |
| Molecular mass | about 4113.6 Da | Average mass of the free peptide |
| Peptide length | 31 amino acids | Backbone related to GLP-1(7-37) |
| Key substitution | Aib at position 8 | Blocks DPP-4 cleavage |
| Albumin binding | Via C-18 diacid side chain | Prolongs circulation time |
The semaglutide sequence is a 31-residue analogue of human GLP-1, altered at three positions relative to the parent hormone. Aminoisobutyric acid replaces alanine at position 8, arginine replaces lysine at position 34, and a lipophilic diacid is attached to lysine 26 through a short linker. These features are reported consistently in the structural literature. The position 8 substitution blocks recognition by dipeptidyl peptidase-4, while the attached chain drives strong, reversible association with a carrier protein in blood.
Receptor activation raises intracellular cyclic AMP through Gs coupling, which promotes glucose-dependent insulin release and suppresses glucagon secretion when blood glucose is elevated. Effects outside the pancreas include slower gastric emptying and altered appetite signalling in the hypothalamus and hindbrain. The relative contribution of each tissue to overall metabolic outcomes remains an area of active investigation. Central mechanisms in particular are inferred mainly from animal models and indirect human measures rather than direct observation.
Serum protein binding dominates the pharmacokinetic profile. The attached chain associates strongly with albumin, shielding the peptide from enzymatic attack and slowing filtration by the kidney. This interaction extends the circulation half-life to roughly one week in humans, which supports weekly administration intervals. An oral version pairs the peptide with an absorption enhancer that transiently alters gastric epithelium, permitting limited uptake; bioavailability by that route is substantially lower than by injection.
Reverse-phase high-performance liquid chromatography with ultraviolet detection near 214 or 280 nanometres is widely used to assess purity and to resolve related impurities. Liquid chromatography coupled to mass spectrometry confirms identity through the protonated molecular ion and fragment ions formed in tandem experiments. Capillary electrophoresis and peptide mapping after enzymatic digestion supply complementary information on charge variants and modification sites. Circular dichroism and nuclear magnetic resonance can report on secondary structure in solution. Absolute quantification usually depends on an external standard, and reported purity depends on the detection wavelength and integration parameters chosen.
Lyophilised material appears as a white to off-white cake or powder that is hygroscopic, and containers are usually equilibrated to room temperature before opening to limit condensation. Dissolution is performed in water, phosphate-buffered saline, or a mildly alkaline buffer, since solubility rises above neutral pH. Gentle inversion or low-speed mixing is preferred, because vigorous vortexing can promote surface denaturation and aggregation. Complete dissolution may require several minutes, and brief sonication is sometimes applied. Passing the solution through a 0.22 micrometre membrane removes particulates but does not by itself sterilise the liquid.
Storage at minus 20 degrees Celsius or lower in a desiccated container preserves the peptide for extended periods, while working solutions are commonly held at two to eight degrees Celsius for short intervals. Light exposure and repeated freeze-thaw cycles accelerate degradation, so dividing material into single-use aliquots is generally recommended. Adsorption to glass and plastic surfaces can lower the measured concentration of dilute solutions, particularly below one milligram per millilitre. The degradation routes most often reported for GLP-1 analogues are deamidation, methionine oxidation, and backbone hydrolysis. Relative rates under specific conditions are frequently described only for individual formulations.
Upon arriving at 25,000 ft, students are removed from their oxygen supply two at a time, for around 2 to 3 minutes. During this time, they will be asked to complete simple tasks such as copying shapes on a piece of paper. They are asked during the time off oxygen how they feel. After being placed back on oxygen, they will understand how their judgement was impaired during the time that they were experiencing hypoxia. The training goes further with rapid decompression profiles, where the chamber is very rapidly ascended from 8,000 ft to 22,000 ft within 10 to 20 seconds, to simulate the loss of a cabin door. For fighter pilots this is done from an altitude of 25,000 ft to 43,000 ft within 5 seconds which simulates the loss of a fighter aircraft's canopy. Hypobaric chambers are also finding increasing use as a means of improving athletic performance. Since the human body adapts to extended mild hypoxia by increasing the quantity of red cells in the blood and this raises aerobic performance, athletes sleep in them as part of their training regimen. This has roughly the same effect as training in high altitudes, but the use of hypobaric chambers plays into the controversial issue of enhanced athletic performance. Mika LaVaque-Manty asks in his book, "Are hypobaric chambers, which simulate high-altitude conditions, a natural way to improve your body?" This hints that the hypobaric chambers use can be likened to blood doping and thus be deemed an unfair athletic advantage. This could lead to a ban on hypobaric chambers for athletic training.
Frozen vegetables are vegetables that have had their temperature reduced and maintained to below their freezing point for the purpose of storage and transportation (often for far longer than their natural shelf life would permit) until they are ready to be eaten. It is a type of frozen food, for food preservation. They may be commercially packaged or frozen at home. A wide range of frozen vegetables are sold in supermarkets. Examples of frozen vegetables which can be found in supermarkets include spinach, broccoli, cauliflower, peas, sweetcorn, yam (in Asia) either packaged as a single ingredient or as mixtures. There are occasions when frozen vegetables are mixed with other food types, such as pasta or cheese. Frozen fruits are produced using a very similar approach. Some popular brands include Birds Eye and Green Giant, as well as supermarkets' 'store brand' items. Frozen vegetables have some advantages over fresh ones, in that they are available when the fresh counterpart is out-of-season, they have a very long shelf life when kept in a freezer and that they often have been processed a step or more closer to eating (usually washed and cut, sometimes also seasoned). In many cases, they may be more economical to purchase than their fresh counterparts or are packaged while ripe. The history of frozen fruits can date back to the Liao Dynasty of China, with the "frozen" pear being a classic delicacy eaten by the Khitan tribes in the Northeastern region of China. Modern frozen vegetables with the flash freezing technique was popularized by Clarence Birdseye in 1929.
A majority of Generation Z disagreed that it was necessary to raise children in a religious household, and only a minority deemed religion to be an important part of their lives. On the other hand, the Pew Research Center found the gap in spirituality among the old and the young to be more modest. In a 2016 poll, Barna found that Millennials and Generation Z were equally likely to require factual evidence before believing in something and to consider the Bible to be at odds with science. The same Barna survey revealed that the percentage of atheists and agnostics was 21% among Generation Z, higher than all previous cohorts. Moreover, whereas in the past, women were broadly more religious than men, during the 2020s, young women secularizing faster than young men, and have become just about as religious as men. Youths who still hold private religious beliefs are also less likely to go to church. When asked what their biggest barriers to faith were, irreligious members of Generation Z pointed to what they perceived as internal contradictions of the religion and its believers. Many also took issue with religious leaders' positions on certain social and political topics, such as abortion, homosexuality, and sex-abuse scandals of the Church. Young women in particular disapproved of the Church's emphasis on traditional gender roles, especially the subservience of women before men, and the culture of purity, such as the insistence that women must dress "modestly" because they were responsible for the thoughts of men.
== In culture == Spider webs play a crucial role in the 1952 children's novel Charlotte's Web. Webs are also featured in many other cultural depictions of spiders. In films, illustration, and other visual arts, spider webs may be used to readily suggest a "spooky" atmosphere, or imply neglect or the passage of time. Artificial "spider webs" are a common element of Halloween decorations. Spider webs are a common image in tattoo art, often symbolizing long periods of time spent in prison, or used simply to fill gaps between other images. Some observers believe that a small spider is depicted on the United States one-dollar bill, in the upper-right corner of the front side (obverse), perched on the shield surrounding the number "1". This perception is enhanced by the resemblance of the background image of intertwining fine lines to a stylized spider web. However, other observers believe the figure is an owl. The World Wide Web is thus named because of its tangled and interlaced structure, said to resemble that of a spider web. Itsy Bitsy Spider is a popular nursery rhyme about the adventures of a spider. Artificial spider webs are used by the superhero Spider-Man to restrain enemies and to make ropes on which to swing between buildings as quick transportation. Some incarnations of the character, such as the version in the Sam Raimi film trilogy and Spider-Man 2099, are shown to be able to produce organic webs. The notable tensile strength of spider webs is often exaggerated in science fiction, often as a plot device to justify the presence of artificially giant spiders.
The four substrates of this enzyme are 4-aminobenzoic acid, reduced nicotinamide adenine dinucleotide (NADH), oxygen and a proton. Its products are 4-aminophenol, oxidised NAD+, water, and carbon dioxide. Nicotinamide adenine dinucleotide phosphate can be used as an alternative cofactor. The enzyme is a flavin-containing monooxygenase that uses molecular oxygen as oxidant and incorporates one of its atoms into the starting material. The systematic name of this enzyme class is 4-aminobenzoate,NAD(P)H:oxygen oxidoreductase (1-hydroxylating, decarboxylating). Other names in common use include 4-aminobenzoate hydroxylase, and 4-aminobenzoate monooxygenase. It uses flavin adenine dinucleotide as a cofactor.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
=== Experimental methods === The absence of long-range order in liquids is mirrored by the absence of Bragg peaks in X-ray and neutron diffraction. Under normal conditions, the diffraction pattern has circular symmetry, expressing the isotropy of the liquid. Radially, the diffraction intensity smoothly oscillates. This can be described by the static structure factor
==== De facto status as puppet state ==== In the months following the intervention, the United States has effectively run Venezuela as a de facto puppet state. Its domestic finances, government appointments, revenues, and oil reserves are overseen by the United States Secretary of State. The Executive Office of the President of the United States has controlled the public appearances and statements by the country's leader, including de facto control over its foreign policy. The Times described Rodríguez as having effectively been "strong armed" by Trump "with the threat of full-scale military invasion if she does not co-operate."
=== As a set === Conceptually a mole is similar to words like "pair" or "dozen". These words describe a set of identical objects—i.e. a collection or aggregate of the objects themselves, not the numbers 2 or 12. The unusual and daunting aspect of a mole is that the number of objects in the set, given by the Avogadro number, is difficult to comprehend. To be useful as a unit, the mole needs to describe the amount in a sample containing a number of atoms (or other elementary entities) that can be manipulated in an ordinary chemistry lab. Atoms are so small that not just trillions but trillions-of-trillions of atoms are needed to create an aggregate large enough to work with.
The antiandrogenic activity of CPA is dose-dependent. Although CPA is a potent antiandrogen, relatively high doses of CPA are nonetheless required for clinically important AR antagonism. The clinical antiandrogenic efficacy of birth control pills containing CPA, which have only low doses of CPA in them (2 mg/day), often can't be distinguished from that of birth control pills containing other progestins. It is likely that the antiandrogenic effects of CPA-containing birth control pills are due mostly to the ethinylestradiol component and/or suppression of androgen levels, rather than the antiandrogenic activity of the small doses of CPA present in them. CPA has been found to decrease inflammatory acne lesions in males by about 15% at 5 mg/day, by 45% at 25 mg/day, and by 73% at 100 mg/day. A dosage of 100 mg/day CPA can achieve a 65 to 70% reduction in sebum excretion rate in males within 4 weeks of treatment, but doses of 10 mg/day CPA or less are said to have a negligible effect. On the basis of these findings, it has estimated that the threshold dosage of CPA to reduce sebum production may be 5 mg/day in males. In other studies, 25 mg/day CPA resulted in substantial improvement or complete clearance of severe acne in almost all males, whereas 12.5 mg/day was ineffective. CPA has been found to be strongly catabolic in young healthy males. It was shown to result in a mean negative nitrogen balance of 1.2 g at 50 mg/day, 1.4 g at 100 mg/day, and 2.5 g at 200 mg/day. This corresponded to mean losses of lean tissue of 780, 945, and 1,515 g, respectively.
Sources: en.wikipedia.org
== Awards and honors == Wadden has received recognition from professional societies and universities throughout his career. Early honors included the President’s New Researcher Award from the Association for the Advancement of Behavior Therapy (1986). He was later elected a Fellow of the Academy of Behavioral Medicine Research (1992), Society of Behavioral Medicine (1995), College of Physicians of Philadelphia (2000), and the Obesity Society (2002). Subsequent honors included the Distinguished Alumni Award from the University of North Carolina at Chapel Hill (2007), the Arthur K. Asbury Outstanding Faculty Mentor Award from the University of Pennsylvania (2007), the George A. Bray Founder's Award (2009), and the TOPS Research Achievement Award (2012), both from the Obesity Society. Other honors included the Bud Orgel Award for Distinguished Achievement in Research (2012) and the inaugural Thomas A. Wadden Award for Distinguished Mentorship from The Obesity Society (2015). Later recognitions included an honorary Doctor of Humane Letters from the Philadelphia College of Osteopathic Medicine (2019), designation as a “distinguished leader in obesity medicine” by the American Board of Obesity Medicine (2021), the Friends of Albert (Mickey) Stunkard Lifetime Achievement Award from The Obesity Society (2022), and the George Bray Outstanding Achievements Award in Obesity Research from the American Society for Nutrition (2025).
Plays a central role in signal transmission speed and integration. White matter hyperintensities Lesions seen on MRI as bright spots in the brain's white matter, often associated with aging, vascular disease, and cognitive decline. Wilson's disease A rare genetic disorder involving impaired copper metabolism that leads to copper buildup in the brain, liver, and other tissues. Neurological symptoms include tremors, dystonia, and psychiatric changes. Wolfram syndrome A rare genetic disorder involving diabetes insipidus, diabetes mellitus, optic atrophy, and deafness (DIDMOAD). Associated with neurodegeneration and mitochondrial dysfunction. Working memory A form of short-term memory that allows temporary storage and manipulation of information necessary for tasks like reasoning and comprehension. Often localized to the dorsolateral prefrontal cortex. Wrist drop A neurological condition caused by radial nerve damage, resulting in an inability to extend the wrist and fingers. Often associated with nerve compression or trauma.
26 July – Three men are killed in a car crash on a road near Dunmore; a woman also involved in the incident is being treated in hospital. The Flow Country of Caithness and Sutherland is named as a World Heritage Site. 30 July – Unison confirms that refuse workers in 14 Scottish council areas will strike from 14 to 22 August. 31 July – The Unite and GMB unions announce eight days of strike action for refuse workers beginning on 14 August, which will include those working for Edinburgh City Council and occur during the Edinburgh Festival.
The consequence of a broken ligament can be instability of the joint. Not all broken ligaments need surgery, but, if surgery is needed to stabilise the joint, the broken ligament can be repaired. Scar tissue may prevent this. If it is not possible to fix the broken ligament, other procedures such as the Brunelli procedure can correct the instability. Instability of a joint can over time lead to wear of the cartilage and eventually to osteoarthritis.
EAS Sports Nutrition (formerly Experimental & Applied Sciences) was a distributor of creatine nutritional supplements with approximately 300 staff, annual sales exceeding $300 million, and offices/distributors in 54 countries.
Sources: en.wikipedia.org
It belongs to the incretin mimetic class and acts as a long-acting glucagon-like peptide-1 receptor agonist. The class includes several peptides with different half-lives and routes of administration.
The side chain enables reversible binding to albumin in the bloodstream, which protects the peptide from rapid renal clearance. This extends the interval between administrations compared with unmodified GLP-1.
No. It shares much of the native sequence but carries substitutions and an added side chain. These changes increase stability against enzymatic breakdown.
It is a modified version of the natural hormone, with three amino acid changes and a fatty acid side chain added. These edits extend its half-life from minutes to about one week. The core receptor activity is retained.